A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
| |
| Authors: | Lili Chen Liyan Song Tingfei Li Jianhua Zhu Jian Xu Qin Zheng Rongmin Yu |
| |
| Institution: | 1.Biotechnological Institute of Chinese Materia Medica, Jinan University, Guangzhou 510632, China; E-Mails: (L.C.); (J.Z.); (J.X.);2.College of Pharmacy, Jinan University, Guangzhou 510632, China; E-Mail: ;3.Guangdong Food and Drug Vocational-Technical School, Guangzhou 510663, China; E-Mail: |
| |
| Abstract: | A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC50 values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. |
| |
| Keywords: | Arca subcrenata peptide antiproliferative activity antioxidant activity |
|
|
